PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g069025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Nin-like
Protein Properties Length: 235aa    MW: 27178.2 Da    PI: 7.5948
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g069025.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK66.24.9e-21125174352
           RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ++++ +d++k+F+ pi+ AA +++v++T+LK++CR+++I RW hRk++sl
  Medtr1g069025.1 125 SSLQYDDIKKHFDVPITMAAEKMNVGVTLLKKRCRELNITRWSHRKLRSL 174
                      68999*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.982115195IPR003035RWP-RK domain
PfamPF020421.1E-17127174IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGIAPFDDFF EFDWATQFSY RSNHIYKNDF DDLENFNFNF NLPHLDQNNF EVDQKPLNVV  60
LPELGHYNHK GETVAESGYV EDSVKTGSGF VSFVKKENEW ENQELSLVPL ALPSSSTGII  120
RKRSSSLQYD DIKKHFDVPI TMAAEKMNVG VTLLKKRCRE LNITRWSHRK LRSLMLLIEN  180
LKEKGLTEEI AMLEKPKKML EKLPGMDLND EIKKLRQACF KANYKNRKLI ALCP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9566190.0CR956619.7 M.truncatula DNA sequence from clone MTH2-65F22 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602270.11e-153RWP-RK domain protein
TrEMBLG7J7G01e-153G7J7G0_MEDTR; RWP-RK domain protein
STRINGGLYMA06G13540.23e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.19e-30RWP-RK domain-containing protein